![]() |
|
Recurdyn 2025 SP1 - Printable Version +- Grand Theft Auto Forum (https://gta.how) +-- Forum: Grand Theft Auto Games (https://gta.how/forum-1.html) +--- Forum: GTA 6 News & Rumors (https://gta.how/forum-2.html) +--- Thread: Recurdyn 2025 SP1 (/thread-63935.html) |
Recurdyn 2025 SP1 - Romdastt - 02-05-2026 Anything you need, just email to: jim1829#hotmail.com change # into @ We supply too many latest softwares, the software list is not full, just email for more software. Ctrl + F to search program with crack If you need a latest software version, please email to: jim1829#hotmail.com change # into @ Oslo Premium 2024 Osstem V-Ceph 8.4 OTANK OTOY Sculptron Outotec HSC Chemistry v9.5.1.5 Output Arcade v1.6.1.4076 WIN Mac Output REV v1.1.1 KONTAKT Overland Conveyor Belt Analyst 16.0.17.0 Overland Conveyor.Bulk.Flow.Analyst.v15 Overloud TH-U Complete 1.1.8 Overture 5.5.4 OVPsim v20120614.0 OxMetrics 7.2 Enterprise Edition Oxygen Forensic Detective Enterprise v12.0.0.151 Ozeki Phone System XE 5.21 Oziexplorer3D 1.08 OZSAD V1.2 pa explorer 2023 v18.0 PackEdge v16.0 & Plato v16.0 PACKZ 10.0 PACSYS.PAFEC-FE.V8.8 PADS 9.4.1 PADS PCB Design Solutions 2004 Build 70.1 PADS PowerPCB 5.0.1 PADS Translator 2007.1 PADS.PCB.2005.Build 7.1 PAFEC-FE.v8.8 Paint.NET 5.0.6 x64 PaintShop Pro 9 Paladin DesignBased v5.1 PaleoScan 2023.1.1 x64 Palisade Decision Tools Suite 2024 v8.5.2.0 Palisade Risk Platform (DecisionTools Suite) 2024 v8.9.0 Palisade.Risk.IndustrialL.For.Excel.v5.5 PALMER_PE_PCMSCAN_V2.4.8 PALMER_PE_SCANXL_ELM_V2.0 PALS2000 R5 v5.0.15 PAMSUITE R2.6 PANalytical HighScore PanaPro Pandat 6.0a Pandromeda Mojoworld v3.0 Professional PanelsPlus v3.2.18 Pangaea Scientific SpheriStat v3.0 Pango Design Suite(PDS) 2022.2-rc3 Win64 Panlab SMART v3.0.06 Pano2VR Pro 7.1.5 Multilingual Win64 PanSystem 2015 Paolo Locatelli AutoRebar 2025 v3.2.2 PaperCut MF 22.0.4 Build 63639 x64 Paraben E3 Bronze Edition 2.5 Paradigm Echos (FOCUS) 14 Paradigm Epos 2023 Paradigm Geolog 2022 Paradigm Interpret 2008 Paradigm SKUA-GOCAD 22 build 2022.06.20 Win64 Paradigm StratEarth 2017 Paradigm Sysdrill 2023 paradigm v2022 Paragon APFS for Windows 4.0.10 Parallel Geoscience Seismic Processing Workshop(SPW) v2.2.12 Parallel SmartSpice 1.9.3.E Parallel.Graphics.Cortona3D.v14.0.1.Win64 Parallels Desktop v19.4.0 Paramarine v6.1 Paramatters CogniCAD 3.0 ParaSoft C++ Test Professional 6.7.4.0 Parasoft CodeWizard v4.3.2.4 ParaSoft Insure++ 7.0.8 Parasoft Jtest 2023.1 ParatiePlus v25 parcam v10 with ext ParkCAD v5.0226 Parker O-ring Division Europe v2.0 parkseis 3.0 PARTdataManager 12.0 Parted Magic 2023.05.21 x64 Partek Genomics Suite 7.19.1125 PartialCAD 3.2 Elefsina exocad3.2 particleworks 2023 PartMaster.Premium.v10.0.1006 PartnerRIP ver9.0 Parts & Vendors v6.0 Pasharp v7.60.9 PASS Pro 2023 v23.0.2 Win64 PASS SINCAL V14_high-performance transmission planning and analysis software PASS START-PROF V4.85 PassMark OSForensics Professional 8.0 Build 1000 Passper for Excel 3.6.2.4 Passper for PDF 3.6.0.1 Passper for Word 3.6.0.1 Passware Kit Forensic 2022.1.0 PASW MODLER 13 (Spss clementine 13) Pathfinder PyroSim PetraSim 2021 Pathfinder v2024.1.0813 x64 PathLoss.v5.0 PathWave Advanced Design System (ADS) 2025 PathWave Electrical Performance Scan (EP-Scan) 2024 Update 1 PathWave EM Design (EMPro) 2023 Update 0.1 PathWave Physical Layer Test System (PLTS) 2022 PathWave RFIC Design (GoldenGate) 2024 Linux PathWave Signal Generation (PWSG) Desktop 2024 v6.2.0 PathWave System Design (SystemVue) 2024 full license Pattern Maker For Cross Stitch v4.04 PatternMaker Marker Studio v7.0.5 PatternMaker Studio 7.0.5 Build 2 Paul Lutus TankCalc v6.9 Paulin Research Group (PRG) 2022 pc dmis v2025 PC OMR v3.0 PC Progress HYDRUS 2D 3D Pro 2.04.0580 PC SCHEMATIC Automation 19.0.2.72 PCA BEAM V2.0 PCA COL v2.0 PCA spBeam v3.50 PCA spColumn v4.81 PCA spFrame v1.50 PCA spMats v7.51 PCA spSlab v3.50 PCA spWall v4.02 P-CAD v2006.SP2 PCAD2009 PCB DipTrace 5.1.0.2 x64 PCB Footprint Expert 2023.13 PCB Investigator 3.41 PCB Navigator 5.1 PCB Router Specctra v16.2 PCB Wizard Pro v3.50 PCB.Matrix.IPC.7351A.LP.Wizard.v7.02 PCBM LP Provisional v2009.20.00 PCBM SymbolWizard Provisional v2.46.03 PCBM SYMWIZ v2.46.03 PC-Crash.v8.0 PCDC RAPT 7.1.4 PC-DMIS 2025 PC-DNC_Suite_v3 PCFLO v6.0 PCI Geomatica Banff 2020 SP2 Build 20200729 x64 PCLGold v.4.0.2 PC-Lint v9.0 PCmover Enterprise 11.1.1010.449 PC-Progress.HYDRUS.2D.3D.Pro.v2.04.0580 PC-PUMP 3.7.5 PC-RECT.v3.0 PCSCHEMATIC Automation v20.0.3.54 PCselCAD v10.03 PCStitch Pro 11.00.12 PCSWMM professional 2023 v7.6.3620 PCWH v3.227 PDE Solutions FlexPDE v7.07 PDF Architect Pro+OCR 9.1.57.21767 PDF Document Scanner Premium 4.33.0.0 PDF Extra Premium 9.40.56318 (x64) PDF Suite 2021 Professional + OCR 19.0.36.000 pdf2cad 11.2108.2.0 pdfFactory Pro 7.46 PDFsam Enhanced 7.0.70.15196 PDF-XChange Editor Plus Pro 10.3.1.387.0 PDI GRLWEAP Offshore Wave 2010-7 PDM analysis scorg 5.1 PDMAX v1.3 PDMS CatView v11.6 PDMS Implant-I v1.5.1 PDMS Implant-stl v1.1.1 PDMS Toolkit v12.0.SP4 PDPS16 tecnomatix16.0 PDQ Deploy 20.10.0.40 PDQ Inventory 19.3.570.0 PDS 8.0 PDsoft 3Dpiping v2.5 PDX Progressive Die Extentions.16.0.0.0 for Creo.4.0 x.10.0 x PEAKS AB 3.5 PEAKS GlycanFinder 2.5 PEAKS Studio 12.5 PeakVHDL Pro v4.21a PeakView v5.0.0 PED Professional v5.0.0 PE-DESIGN 11.31 PEGASUS Peloton wellview v9.0.20111208 pentagon_3d_all PentaLogix CAMMaster Designer 11.18.1 PentaLogix FixMaster v11.2.4 PentaLogix ProbeMaster 11.0.83 PentaLogix RoutMaster v9.4.30 PentaLogix ViewMate Pro 11.18.1 PEoffice 5.7 PEPS.7.014 PEPSE GT version 82 Percepio Tracealyzer 4.10.2 Peregrine Labs Yeti.4.2.11 PerFect.Photo.Suite.v7.0.1.MacOSX PerfectDisk Professional Business Server 14 Perfectly Clear WorkBench 4.5.0.2520 Perforce Helix Core 2024.1 x64 Win Mac Linux Perform 3d V8.0 Performance Trends Engine Analyzer Pro v3.3 PerfQuery v10.1.7, PolarManager v3.1.4, RaceReplay v14.2.25 PerGeos 2023.2 x64 PERI ELPOS v4.0 PERI PeriCAD FormWork v3.0 PeriCAD 2006 for Autodesk Architectural Desktop 2006 PerkinElmer ChemOffice Suite 2022 v22.2.0.3300 Perla.Premium.Build 2754 Full Permas 2023 Permedia Mpath v4.16 Persyst EEG Suite Pertmaster Project Risk v7.8.1031 Peters Research Elevate v9.2 Petex IPM 12.5 Petra 3.18 PetraSim 2022.2.0621 Petrel 2024.6 with plugin Petrel+Techlog+Kinetix+Visage+IX+Eclipse+Pipesim+OFM2024 petrel2024+ecl2024+kinetix2024+visage2024+intersect2024 PetrisWinds.Recall.v5.4.2.013.Win32 PetroClass FlowTest 5.0.1.6 petroleum experts ipm 13.0.472 Petroleum Experts MOVE 2020.1 x64 Petroleum Solutions Suite 2023 Petroleum Toolbox V10.0 Petrolog v10.5.3.128 petromod 2023 PetroSim 7.2 Petrosite.v5.5 Petrosys PRO 2023.1.4 Peysanj v5.2.2021.1125 PFC 6.00.8 PFC2D 9.10 PFC3D 9.10 pfCAD Catasto v20.00 PFCAD v2.0 PfCAD.COGO.v16.0 PFWIN GR v1.1 for Windows PG Music Band in a Box 2023 PG-STEAMER.RTP.v4.1 PHA-Pro 8.21 PHAROS V9.13 Phase2 v7.019 Phast Safeti 9.0 + kfxlite 4.0 PHAWorks RA Edition 1.0.9382 PHDWin v3.1 Phoenics v2009 phoenix winnonlin 8.5 Photogrammetria ScanIMAGER Standard Plus v3.2.0.1 Photometric Toolbox PE 1.87 Photometrix.Australis.v7.13 photomod 7.1 photomodeler premium 2022.1.1 PhotoModeler Scanner 2021 PhotoModeler UAS 2021 Photon Design FIMMWave v3.6 PhotonicSolutions MetaOptic Designer CAD 2022 PhotonicSolutions OptoDesigner 2024 Photopia 2023 PhotoPrint 24.1.0 Photoscan 1.8.5 Photoscan linux 2.1.3 Photoshop Fine Arts Effects Cookbook Photron Primatte v1.1.0 for Fusion v5.2 PHPRad Vue 2.6.4 + Classic 2.6.7 PHPRunner Enterprise 10.91 x64 PhraseExpander Professional 5.9.6.0 PhraseExpress 16.2.5 PHX ModelCenter v9.0 Physical Properties Estimation Database v3.6.1 Physprops v1.6.1 PI Expert Suite 9.1.6 x86 x64 PIC C Compiler (CCS PCWHD) 5.115 PiCAD 2008 PicaSoft HandyCut.v1.0.14 PicaSoft HandyScan.v1.0.23 PicaSoft MayKa Suite v6.0 Picasoft Stenza v1.1.47 PicBasic Pro v2.46 PICS3D 2022 PicSender v3.3.5 PIE-Basic 6.3 PIE-Hyp 6.3 PIE-Map 6.1 PIE-Ortho 6.0 PIE-SAR 6.3 PIE-SIAS 6.3 PIE-UAV 6.3 pIGI 3.5.1 Pile Cap Analysis and Design v2013.11 Piletest.PileWave.v5.1 Pilot3d v1.222 PilotLogic GaiaCAD 2.000 Pinguin Audio Meter 2.2 Pinnacle Commotion Pro v 4.1 Pinnacle FracproPT 2013.v10.6 Pinnacle Liquid v7.2 Pinnacle Studio Ultimate v25.1.0.345 (x64) Pioneer DJ rekordbox Premium v6.7.0 WiN Pioneer Hill Software SpectraPLUS v5.0 Pipe and Fitting v3.2.1 for Android PIPE FLO Advatage.18.1 Pipe Flow 3D 1.042 Pipe Flow Expert v8.16.1.1 Pipe Flow Wizard 2.1.3 Pipedata-Pro 15.0.04 Pipedrop v1.2.6 PIPEFLO 9.5.6.3 PIPE-FLO Advantage 2022 v8.1 PipeFlow 3D v1.402 PipeFlow Advisor v1.11 PipeFlow Expert 2023 v8.16.1.1 PipeFlow Wizard v2.1.3 PipeLay V3.4.1 pipeline studio v5.2 Pipeline.Toolbox.Enterprise.V18.1 pipenet v1.11 PIPENET VISION 2017 Pipesim 2023.1 PipeTech v6.0.42 Piping Systems FluidFlow 3.53 pirana v3.0 PISCATUS 3D v5.0 Piste v5.05 Pitney Bowes MapInfo Pro v2023.97 (x64) Pitney.Bowes.Encom.PA.2012 pitshop pro 2020 PIVR Vred v601 Win64 PIX4D Fields 2.8.3 Pix4Dmapper 4.8.2 pix4dmatic v1.72 Pix4Dsurvey 1.68.1 Pixaloop - Photo Animator & Photo Editor Pixar RenderMan Artist Tools v6.5.1 for Maya7.0 PIXAR_RENDERMAN_STUDIO_V1.0.1_RENDERMAN_PRO_SERVER_V13.5.2 Pixarra TwistedBrush Pro Studio 26.03 Pixel Composer 1.19.0.2 x64 PixelGenius.PhotoKit.Color.for.Adobe.Photoshop.v2.1.3 PixelLab Redshift Lighting Essentials for Cinema 4D Pixelplan.Flow.Architect.Studio.3D.v1.8.7 PixelPlanet PdfGrabber 9.0.0.10 Pixologic Zbrush 2024.0.4 PixPlant 5.0.38 x64 PiXYZ Batch 2021.1.1.5 PiXYZ Complete 2021.1.1.5 Win64 PiXYZ Plugin (Unity) 2021.1.1.5 Pixyz Review 2022.1.2.7 PiXYZ ScenarioProcessor 2021.1.1.5 PiXYZ Software PiXYZ Studio Batch 2019.2.0.57 Pixyz Studio 2025.1.0.5 x64 PL7 Pro v4.4 Planary for Revit/Autocad v4.1.1 PlanBridge 3.7 for Microsoft Project x86 x64 Plancal.Nova.v6.2 Plane Failure Analysis v2.1 PlanetPress Suite 6 Planetside.Software.Terragen.v0.9.43 PLANETSIDE.TERRAGEN.V2.3 PLANIT EDGECAM V2014 R1 Planit Millenium II Planit Software MAZAK FG-CADCAM 2020.0.1932 Planit.Cabinet.Vision.Solid.2024 Planit.Fusion.v12 Planit.S2M.2012.R2 Planmeca Romexis 2024 6.4.6 PlanSwift Pro Metric 11.0.0.129 Plant 3D Addon for Autodesk AutoCAD 2024 x64 PLANT-4D v7.7.03 PlantCatalog.2023.3.9006238 PlantPAX v3.0 + LVU Tool PlanTracer Pro v3.0.79 PlantWAVE PDMS v3.99 Planworks Tables v.2025.1.0.0 Plassotech.3G.Author.2005.R1 Plastic SCM Enterprise Edition v10.0.16.5328 Plasticity CAD for artists 1.4.11 Plastics 2012 SP4.0 for SolidWorks 2012 PlastyCAD v1.7 Plate N Sheet Professional v4.13.10 PLATEIA 2010 build 281 Plate'n'Sheet 4.13.10 PLATFORM ID 2.0 Plato 6.2.12 Platte River Associates (BasinMod) 2021.8.27 PLAXIS 2D 3D Ultimate 2024.2.0.1144 Plaxis 3D Foundation v1.6 Plaxis 3D Tunnel v1.2 PLAXIS LE CONNECT Edition (SES) Update 7 v21.07.00.43 Win64 Plaxis Mode to CONNECT Edition V20 Update4 v20.04.00.790 Win64 PLAXIS Monopile Designer CONNECT Edition V22 Update 2 Plaxis Professional v8.5 PLAXIS Suite Ultimate 2D&3D CONNECT Edition 24 PlayerFab 7.0.4.1 PlCAD v2.75 PLC-Lab Pro v3.3.0 PLCLOGO Soft Comfort V8.2 Plexim Plecs Standalone v4.9.4 Win64 Plexon Offline Sorter OFS 4.7.1.0 Plexon PlexUtil 4.0.2 PLEXOS 9.0 x64 Plexscape Plexearth 2.5 PLOT EXPRESS zeh 5.1 Plot v19.0.7775.16116 PlotLab Visual C plus plus v2.2.1 PLS-CADD v16.81 Plug And Mix VIP Bundle Plugin Alliance MEGA Sampler 2022 Plum Amazing iWatermark Pro 2.5.23 Pluralsight Object-oriented Programming in C# 10 2023-3 PMA Software BlueControl v2.8 SR3 PMI Suite x64 (Byos and Byosphere) v5.9.121 PneuCalc.v7.0.1 PocketStatics 2.01 for Pocket PC 2003 (Windows Mobile 4.0) PocketStatics 2.01 for Windows Mobile 6.0 (including Phone Edition) PointCab 3D Pro v4 PointCab 4.1 PointCab 4Archicad 1.1R1 PointCab 4AutoCAD 2.0 PointCab 4BIMm 24.01 For ArchiCAD 24 PointCab 4Brics 2.0 PointCab 4Revit 2.0 PointCab Origins 4.1R4 PointCab Software PointCab 3D-Pro + Register v3.3 R0 Win64 PointCabOrigins Pro 4.2R14 PointMesh 2024.1 Pointools CONNECT Edition 10.0.2 Pointools Edit Pro v1.5 Win64 Pointools POD Creator v1.1 Win64 Pointools View Pro v1.8 Win64 PointSense 9.0.5.14 for autocad 2013-2014 PointShape Design 1.5.2 PointShape Editor 1.2.0 PointShape Inspector 2.19 Pointwise v2022.2.2 Polar Instruments CGen 2021 v21.06 Polar Instruments Si8000 10.01 + Si9000 11.04 Fixed Polar Instruments Si8000m 2022 v22.04 Polar Instruments Si9000e 2022 v22.04 Polar Instruments Speedstack 2022 v22.07 Polar SB200a Professional v6.0 Polar SI9000 2022 V22.03 Polar.Bowler.v1.0 POLAR.INSTRUMENTS.SB200.V2.100 POLAR.SB200A.STACKUP.VIEWER.V2.1 Polar.SI9000E.Field.Solver.v6.00 Polarion ALM 21_R1 PolyBoard CalepiLight OptiCut StairDesigner OptiNest PolyBoard Pro-PP 7.09a + Quick Design libraries Polymath Professional 6.10 Build 260 PolymerFEM PolyUMod v6.4.2 + MCalibration v6.6.0 Win64 & Linux64 PolyPattern US80 v1 full Polysun v11.2 Win64 Polytec VibSoft PolyUMod 2022 PolyWorks Metrology Suite 2024 IR3.2 x64 Porsche Piwis 3 SD Card v40.000 Portable Arguslab v4.0.1 Portable CalcMaster 6.1.0 Portable ChemSketch v11.2 Portable GSView v4.9 Portable MestReC v4.9.9.9 Portable RISAFoundation 2.1.0 Portable Tinker v4.2 Portable Working Model 2D v8.0.1.0 Portunus v5.2 poseidon 21.4 DNV GL Pospac MMS v9.2 Post Processing for DJI RTK Drones v1.2.1 Poster v8.4 PosterGenius.v1.5.11.0 PostgreSQL Maestro 23.9.0.1 PostRIP 9.0 PostSharp 6.10.15 PotPlayer 1.7.21915 x86 x64 Power BI Report Desktop + Server May 2023 Power Connect v5.0 Power Music Professional 5.1.5.7 Power Shelling v1.0 for SolidWorks 2022-2022 Power Surfacing RE v8.0 for SolidWorks 2020-2023 Power v4.5.6 R7 Power World Simulator v8.0 Power.Surfacing.v5.1.for.SolidWorks.2019.Win64 PowerACOUSTICS 3.0b 2013 PowerCLAY 2.4a 2006 POWERCONNECT 2008 v5.0 PowerCONVERTERXP.v5.0.115.R95b PowerDELTA 2.0a 2013 PowerFactory v2024 PowerFlow 4.4b PowerFlow PowerACOUSTICS PowerDELTA PowerCLAY PowerFrame v4.8 PowerISO 8.5 powerlog frac 9.5 PowerLogic v1.1 Powermill Ultimate 2023 PowerMockup 4.3.3.0 PowerPack for Advance Steel 2023 PowerPCB with BlazeRouter 5.0.1 PowerPlate Master v3.9 PowerRail Track V8i 08.11.07.615 PowerShape Ultimate v2023.1 Powersim Studio Express v7.00.4226.6 PowerSurfacing 10.0 for SolidWorks PowerSurfacing RE v2.10.9769 POWERSYS EMTP-RV 3.0 Power-user Premium 1.6 PowerWorld Simulator 22 Precisely MapInfo Pro v2023.1.181 Precision Mining SPRY v1.6.2.1036 Predator CNC Editor v10 Pre-Design v1.0 Predict v6.1 Predict-K 15.6 PREeSTOV 8.6.1 Premier System X7 17.7.1287 Prepar3D V5.4.5.4.9.28482 Prepros 7.26 Prerequisites and Common Tools for AutoPLANT Applications v8i 08.11.11.113 Win64 Prerequisites for Bentley Desktop Applications v08.11.09.03 PreSonus Studio One 6 Professional v6.6.1 x64 PressCAD Pro v2010 PressSIGN Pro v12 Prezi Next 1.30 Prezi Pro v6.16.2.0 PRG Paulin V2022 Primatech PHAWorks RA Edition v1.0.9704 Primavera Developement Kit v3.0 Primavera Expedition v10.1 Primavera P3e-c.for.Construction.5.0 Primavera P6 Professional 22.12 x64 Primavera Project Management P6 Release 8.2 Primavera Project Planner v3.3.0 Primavera TeamPlay Client v2.9.44 Primavera v6 PrimCAM V3.0.12 PRIMEFOCUS DEADLINE VERSION 4.1 SP1 Primer Premier v6.0 Primesim Hspice 2022 linux64 Prinect Package Designer Suite 21.10 Build 26.2131 Prinect Signa Station 2022 Prinergy 10.0.0 BLD82 Print Conductor 8.1.2304.27160 Print2CAD 2024 AI v24.21 x64 PrintPro Print Pro GW-SLA 3.6.252 priPrinter Professional Server 6.9.0.2541 Prism 9.1.1 mac prism Interpret 2014 Prism SADiE Sound Suite v6.1.16 x64 Pro ENGINEER Routed System Designer 6.0 M040 Pro ENGINEER Wildfire 5 (recommended datecode M280) PRO SAP 22.5 x64 PRO600 2014 for MicroStation V8i Win32 Proach v1.05 ProArt & ProLace v2.0 ProbeMaster v11.0.56 CAMMaster v11.6 FixMaster v11.0.5 PROCAD 2D Plus 2024.0 (x64) PROCAD 3DSMART Plus 2023.0 (x64) ProCad developer 14 PROCAD Spoolcad+ 2024 (x64) procam dimensions 6.1 ProCAM.II.2006 Procast 2023 Linux Procedural.Cityengine.2010.3.SR2 Process Engineering Tools (PETS) 5.2 Process Lasso Pro 12.2.0.16 x86 x64 Process Systems Enterprise gPROMS v4.2 Process.AID.Wizard.for.UG.NX.2.0 Process.IVE.DIE.Wizard.for.UG.NX.v2.0 Processing Modflow X 10.0.23 ProcessModel.v5.0 procon win 3.5 proDAD Adorage 3.0.135.6 proDAD DeFishr 1.0.75.3 proDAD Heroglyph 4.0.260.1 proDAD Mercalli V6 SAL 6.0.629.1 proDAD ReSpeedr 2.0.210.1 proDAD VitaScene 4.0.297 (x64) ProDelphi Professional v17.5 ProDrill V3 MR2 Mastercam X4 Mu1 Win32 Production Manager 24.1.0 Proektsoft Design Expert 2022 v3.6 Proektsoft PSCAD 2022 v3.4.26 Proel Millennium III v3.4.1 Pro-EMFATIC (P-EF) v3.1 3.1 1 Pro-face EX-WINGP-PCAT Pro-face GP-Pro EX 4.09.100 / GP-PRO/PBIII 7.29 Pro-Face WinGP ProfiCAD 12.4.6 Proficy Machine Edition V8.0 Profil Tec 6.0.7.0 Profile Builder 4 PROFILE MASTER 2000 CAM-DUCT v2.26 Profili v2.30C PRO ProFirst Group LogiTRACE V14.2.2 Proflt v10.4 ProFound Effects Gak Pak v2.0 for After Effects Progea Movicon NExT 2019 v3.4.263 x64 ProgeARC 2006 for ProgeCAD ProgeCAD 2025 Professional 25.0.2.11 x64 ProgeMEC v2006 For ProgeCAD Progen Proteus 2024 linux ProgeSOFT IntelliCAD v4.8.1 Gold Progesoft progeCAD 2025 Professional 25.0.2.11 Programa Allfusion Erwin 4.1 Progress.OpenEdge.v10.2A Progressive.Die.Extension.v5.0 Progressive.Die.Wizard.for.UNIGRAPHICS.NX.V3.0 PROII v2022 Project Engine Server And Client Enterprise Edition v2007.7 Project.Messiah.Studio.Pro.v6.0.Win32_64 ProjectWise Navigator v.8i 08.11.07.171 Prokon CalcPad v2.1.09 PROKON Structural Analysis and Design v5.0 build 06.07.2022 PROKON v5.0 build 06.07.2022 Pro-Lambda Pro-EMFATIC.P_EF.v3.1.Win32_64 prolink III v4.8 promax 5000.10.0.3 ProMax 6.0.23032.0 Prometech ParticleWorks 8.0 Win Linux Promis.e 2024 (24.00.00.084) Promodel v4.22 Full Promt Professional NMT 23.0.60 ProNest v2022.Build.13.0.4 PROOSIS (PROPULSION OBJECT-ORIENTED SIMULATION) PropCad Premium 2023 PropElements 2023 PropertyLinks 2012.0.0.3 for Solidworks 2012 PropExpert 2023 ProPlan v3.6 ProPresenter 7.16 ProSafe-RS R2.03 ProScanning lidarScan 6.0 V6.0.1.429 Proshake 2.0 ProSightPC v4.1.22 ProSim Plus v1.9.20.0 ProSim Simulis Thermodynamics (ProPhyPlus) 2.0.25.0 ProSim Simulis Thermodynamics v2.0.25.0 + Component Plus v3.6.0.0 ProsimgraphsPro v11.0 Prosoft.Flow.Pro.v2.1.Win32 ProSource Software v10.27 Win64 ProSteel 3D v8i (08.11.00.11) for AutoCAD 2004-2009 ProStructures CONNECT Edition 2024 (24.00.00.037) ProStructures for Autodesk AutoCAD 2019 ProtaBIM 2016 sp5 for Revit 2015 ProtaStructure Suite Enterprise 2022 v6.0.512 Protectorion PC&Protectorion ToGo Protein Metrics PMI-Suite v5.8 ProteinPilot 5.0 Proteome Discoverer 3.1 Proteus Engineering Maestro v9.1.0 Proteus Pro v8.17 SP5 Build 39395 Proton Development Suite v3.5.2.7 PROWARE METSIM v2022 pRTI 1.3 ps brcm 2022 PS.FluidFlow.v3.22.5 PS2000 R5.0 PSASP 7.72 Psat v5.1 PSBeam v4.61 PSC Design Kit 3.3 Linux PSC SmartCtrl 2024.1 PSCAD Professional 5.0.2U2 x64 2024.9 PSD to 3D v9.9 PSD-BPA PSDTO3D v9.9 PSE gPROMS Suite 2023 x64 PSG 3D 2024 PSIM Professional 2024.0 x64 PSoC.Designer.Incl.C.Compiler.v4.0 Pspice v9.2 PSR SDDP 17.2 x64 PSS ADEPT v5.16 PSS E Xplore v34.3.2 PSS SINCAL Platform 19.5 x64 PSS Viper v3.0.4 PSSE PSS/E 35.5 50000 BUS PSSE PSS/E 36.0.1 Psunami Water v1.0 3d PT Group OLGA 2022 PTC Arbortext Family 2021-08-28 PTC Cero Elements direct modeling drafting 20.7 OSD 20.7 PTC Creo Illustrate v11.1.0.0 x64 PTC Creo Schematics 11.0.1.0 x64 PTC Creo v11.0.4.0 PTC Creo View 11.1.0.0 x64 PTC Mathcad Prime v11.0.0 x64 PTD v2.1.25 PTDesinger v1.1.0 PTGui.v3.5 PTV VISUM v11.52 pty vissim 2025 Pulse.Tajima.DG.ML.v11.0.5.2633 Pulsim Suite 2.2.6 x64 Pulsonix 11.0 Pulsonix.Advanced.Electronics.Design.System.v2.0 PUMPAL64_8.9.12.0_64bit PumpBase 2.0c Pumpcalc v7.00 PUMP-FLO v10.0 Pumplinx v4.6 Punch Software Shark FX 9.0.11.1210 Punch v7.1.1 Punch!.Home.Design.Studio.v12.0.MAC.OSX PureBasic 6.02 LTS Windows Linux macOS PV ELITE v27 U1 2025.4.18 PV*SOL Premium 2023 R5 PVCAD Mega Bundle 31.0.1.0 PVCase v2.48 for AutoCAD PVelite v27 PVS231 PVSOL premium 2025.5.8612 PVS-Studio v7.15.53142 PVsyst 7.4.8.38383 PVTsim Nova 6.1 PVTsim v20.0 pycharm Professional 2022.3 PyImageSearch University Complete Bundle 2021-10 PyMOL 3.1.1 Windows macOS Linux PyroSim v2024.1.0702 x64 Pythagoras CAD+GIS EN 2023.00.0011 Win64 PYWALL v3.0.9 Q3D Extractor 12.0 qbase+ 3.2 x64 QbD Risk Assessment 1.4.3 Qbitec for Revit v1.0.11 Qbitec v1.1.1 for Autodesk Revit 2022-2025 Qbitec.for.Revit.v1.0.9 QCAD QCAD CAM Professional 3.32.2 Q-Chem 5.4.1 QCoherent LP360 2018 QEDesign2000 Qfinsoft Qfin 5.1 QForm V9.0.9 Qimage Ultimate 2020.101 Qimera FMGT 7.11.1 Qiteam 2018 QlikView Desktop Server Edition 12.50 SR4 qlucore omics explorer v3.8 QMSys GUM Enterprise v5.1 Qmsys.Tolerances.And.Fits.v5.4 QNX.Momentics.Development.Suite.Professional.Edition.v6.3 QNX.Neutrino8.v6.2.1.NC QNX.Realtime.Platform.v6.10 Qpiping v3.2 for AutoCAD 2002 QPS Fledermaus v8.7.0 QPS Qastor 3.4.0 QPS Qimera v2.7.3 QPS Qinsy 9.6.5 QSR NVivo 12.2.0.443 Plus QSR XSight 2 QtiPlot 1.1.3 quadoa 2022 QuadriSpace Document3D Suite 2024 SP0 x64 QuadSpinner Gaea 1.3.2.7 Quadstone Paramics v6.4.1 QuakeManager Advanced 2.0 x64 Qualisyst.QMSys.GUM.Enterprise.v4.6.Build.10.09.09 Qualisyst.QMSys.Threads.and.Gauges.v5.6 Qualnet tool 6.2 Qualoth v4.7-7 for Maya Quanser Quarc 2.6(Matlab 2017a) QuantAnalyzer PRO 4.9.2 x64 QuantifierPro v1.1.2 Quantm Desktop v8.3.1.2 Quantum GIS 3.26.3 Quantum3D OpenGVS v4.5 Quantum3D VTREE SDK V4.02 QuantumATK W-2024.09 Quantumwise Atomstix Toolkit v11.8.2 QuarkCopyDesk 2021 v17.0 QuarkXPress 2025 v21.0.2.57437 Quarry v6.3 for Surpac Quartus_12.1_x64 crack Quest Central For Databases 6.1 Quest Migrator v6.2 Quest Software ApexSQL Suite 2022 Quest.CANARY.v4.3.0 Quest3D VR Edition 4.0.0 Questa Formal CDC 2023.4 Questa Sim2024.3 QUESTOR 2023 Q1 Quick Fringe v4.52 Quick Terrain Modeler v8.4.3 QuickBooks 2023 Enterprise Pro QuickConcreteWall 5.6 Quicken WillMaker & Trust 2025 v25.3.3027 QuickFooting 5.6 Quickie CAD Symbols v1.0 QuickMasonry 5.6 QuickRWall 5.6 QuickSurface 2025 v7.0.14 QuikLogic.QuickWorks.v9.8.4 QuikSoft Merlin v5.35 QuikSoft QuikBeam v4.20 QuikSoft.QuikEC3 v1.11 QuikSoft.QuikFrame.v8.42 QuikSoft.QuikJoint.v8.20 QuikSoft.QuikPort.v7.22 Quint Optishape-TS v2010 R1 Quite Hot Imposing 5.3d Quixel Mixer 2022.1.1 Quixel Suite v1.8.x64 QuoVadis v7.3.0.38 Quux Sincpac C3D 2023 v3.34 for Autodesk AutoCAD Civil 3D 2023 R&B ElectrodeWorks 2022 SP1 for SolidWorks 2015-2024 Win64 R&B Mold Design Products for SolidWorks 2015-2024 2024-8 R&B MoldWorks 2022.SP0.2.Win64 R&B SplitWorks 2022 SP0 for SolidWorks 2015-2025 x64 R&L CAD Plate 'n' Sheet Professional 4.20.02 R&S ES-SCAN R2GATE 2021 R2gate implant surgery 2021 R3DS Track 2020.06.1 (x64) R3DS Wrap4D Track Node Rush 2021.11 Win x64 Raceway and Cable Management CONNECT Edition Update 11.2 RAD Studio Delphi v2007 RAD.Studio.XE radan 7.5 RADAN Radm-ax 2020.0.1932 Win64 RadarOpus 2.2.16 RadiAnt DICOM Viewer 2025.1 Radiant ProMetric 8.5.77 Radiant Vision Systems ProSource 10.2.7 Radimpex Tower 2022 & ArmCAD 2022 & MetalStudio 2022 Radish Works Cosmos Creator v1.9.866 RadSystems Studio v8.7.0 Radtherm v7.01 Linux Radzen Blazor Studio 1.9.6 Radzen Studio 2.84.4 Railroad and Co TrainController v5.5B1 Railroad and Co TrainProgrammer v5.5B1 Raily.for.Windows.v4.06 RainCAD 2014 for AutoCAD Raindrop Geomagic CADmus Fashion V6.0 Raindrop Geomagic eShell 8.0 SR0 Raindrop GeoMagic Qualify 11.0 Raindrop GeoMagic Studio 11 Raisonance Ride v6.3.1 RAM ADVANSE v5.1 RAM Concept 2024 (24.00.01.028) RAM Connection CONNECT Edition 2024 (24.00.04.05) RAM Elements CONNECT Edition V2024 (24.00.04.05) RAM SBeam CONNECT Edition V7 (07.00.00.111) RAM Structural System CONNECT Edition 2024 v24.00.02.51 ramms avalanche 1.7.20 RAMMS DEBRIS FLOW v1.7.20 RAMMS ROCKFALL V1.6.70 RamSeries Professional v11.0.5 Rand 3D Caliper for Pro E Wildfire v2.0 Rand Automation Gateway For Pro E Wildfire v4.2 Rand TailorMade Configurator v2.1 Ranges6 v1.2195 Ranorex Studio Premium v11.6.1 ransvalor Forge v2011 Raphael 2024 Rapid Resizer v3.4.1 RapidForm v2006 Rapidform XOR2 rapidlasso LAStools Suite 2024.6 RapidMiner Studio Developer 10.3 x64 RAPT V7.0.5.0 Rasterex RxView & RxHighlight v12 Rasterstitch.Panorama.v3.0.Win32_64 Rastervect v5.8 Rational Acoustics Smaart Suite 9.1.6 rational DMis 7.1 Rational DOORs 9.6.1.11 Rational Rose 2007 v7.0 RATIONAL XDE DEVELOPER FOR .Net V2003 Rationaldmis 2022 Rave Reports v2022 for Delphi 7-11 Alexandria RavenDB Enterprise Edition v5.4.5.0 Raxco InstantRecovery Server 2.5.0.325 Raydata ventuz 6 RayViz 2024 RazorSQL 10.4.2 Windows Linux macOS RBF Fluent v16.2 Ansys v16.2 Win64 RCB v2.2.13 RCC v1.2.4 RCDC (SACD) Connect Edition 23.00.00.98 RCDC FE CONNECT Edition V4 Update 1 RCM ACI-Builder v4.4.5.1 RCP Developer v5.0.0 RCS Software 7.20 RdpGuard 8.8.3 Reaction Design Chemkin Pro v15.13.1 Reaction.Engineering.Lab.for.Comsol.Multiphysics.v3.3a.Update.Only Readiris Corporate 17.3 Readiris PDF Corporate & Business 23.1.37 Readiris Pro 16.0.0.9472 Real Steel v3.2 for AutoCAD 2002~2006 Real3D Professional v24.0 Win64 Real3d Scanner v3.0.304 RealCut 1D v11.2.5.0 with Angles RealFlow.2014.v8.1.2.0192 RealGuide 5.4 2024 RealHACK 7.0 for SolidWORKS 2010-2022 Realistic Embroidery 3.0 realityCapture 1.3 Reallusion 3DXchange 7.41.2525.1 Pipeline x64 Reallusion Cartoon Animator 4.02.0627.1 Reallusion Character Creator 4.4.2405.1 (x64) Reallusion iClone Pro 7.61 x64 RealPic Simulator v1.3.0.0 Realtime Analyzer RAL 2.0.0.1 Realtime Landscaping Architect 2025 v25.00 x64 RealView Development Suite 4.0 RealView MDK-ARM 4.12 RealVIZ Stitcher Unlimited v5.5.1 REALVIZ VTour 1.1 Realviz.ImageModeler.v4.02 Realviz.Movimento v1.0 REALVIZ_MATCHMOVER_PRO_V4.0 REALVIZ_Stitcher_v4.0.2 RealVNC VNC Server Enterprise 7.5.0 Win 6.10 macOS Reason Studios Reason v12.5.3 RebarCAD 2021 Rebex Total Pack for .NET v6.0.8000 Rebro BIM 2022 ReconstructMeQt 1.2.103 Recording Studio 10.6.635 RecurDyn.v8R2.SP1.1.Win32_64 Recuva Professional Business Technician 1.53.2095 RED CAD 3.14.10.0 RED CAD APP v3.23.2 Red Gate .NET Reflector 11.0.0 Red Giant Complete Suite 2021 for Win Red Giant Composite Wizard v1.2 for After Effects Red Giant iMage Lounge v1.2 for After Effects Working Red Giant Magic Bullet Suite 2025.0 (x64) Red Giant PluralEyes 2023.0.0 (x64) Red Giant Shooter Suite 13.1.15 Windows 13.1.11 macOS Red Giant Trapcode Suite 2025.0 (x64) Red Giant Universe 2025.0 (x64) Red Giant VFX Suite 2025.0 (x64) Red Hen Media Geotagger v3.2 RedCrab Calculator Plus 8.1.0.801 RedGate SQL ToolBelt 2023-4 .NET Reflector 11.1.0.2167 Redhawk 18.0 RedHawk-SC Electrothermal 2023 R2.1 Linux64 RedPup.Ornamental.Pro.2010.v10.3h Redshift 8.2 Premium Redwirez BIGbox Vintage Classics IR Pack v1.0 ReefMaster 2.2.60 ReefMaster Sonar Viewer 1.1.42 ReefMaster Waypoint Manager 1.17.30.0 ReferenceWorks Professional 4.2.8.8 ReflectorCAD 2016 Reflex 2D Quick v1.21 Reflex 3D Scan v2.0 ReflexW V10.2 Ref-N-Write 6.0 REFORM-3PC.V7.0 REFPROP 9.0 refract 3.0 Reg Organizer 9.20 x64 x86 RegDllView 1.57 Reinforcement Detailing v2021 Reinforcement Generation v2021 ReiWorld Staad Beam v2.0 reliasoft v2024.2 Reliotech Top Event FTA 2017 v1.2.2 Relyze Desktop 4.0 X86 X64 Remcom Rotman Lens Designer(RLD) 1.7 Remcom Wireless InSite 3.4.4.11 Remcom XFDTD 7.10 Remcom XGTD 2019 Remo3D v2.91 RemObjects Elements 11.0.0.2661 Hydra 6.2 Remote Desktop Manager Enterprise 2024.1.32 Rename assemblies and parts v5.0 for Inventor 2022-2018 Renault DDT2000 2.0.9.0 Renault Reprog v191 (10.2020) Renee PassNow Pro 2024.03.27.148 Renesas High-Performance Embedded WorkShop V3.1 Renesas.CC32R.v4.30 Renesas.NC308WA.v5.20 Renesas.NC30WA.v5.30 Renga Architecture 6.1.50957 Renga Professional v8.3.15424 x64 RePlot v1.8.0 CAD Res2Dinv v2024 Res3Dinv v2024 Research Mathematica v7.0 Research Systems Envi v4.2 Research Systems IAS 2.2 Research Systems IDL v6.0 Reservoir Evaluation Programme(REP) v527b4 ResForm GeoOffice V3.5 resform start 5.2 2024 ReSharper Ultimate 2024.1.0 Resolume Arena v7.20.1 ReSpectrum 2005 RE-Studio-Eclipse-2017.06.7537 x64 ResView 7.1.15 Retaining Wall v8.0 RetainPro 11.18.12.04 forever license RetainWall v2.0 Retas Studio 6.6 RETScreen Expert Professional 9.1.0.98 Revisionfx Reelsmart Motion Blur Pro v3.2.5 for DF4 Fusion5 Revisionfx Reflex v3.1.1 for Fusion5 Revisionfx Twixtor Pro v4.52 for AE Revit extensions 2010 for Robot 2010 Revit Project Browser 2013 RevMan 5.4 Revolutio CHECKPOLE v10.1.3+CHECKSTEEL v4.1.6+CHECKWIND v8.1 Revolutio Software 2024 Revworks 2001 SP1 for Solidworks reZonator v2.0.5 beta1 Win32 RF.Module.for.Comsol.Multiphysics.v3.3a.Update.Only RFD tNavigator 2022 RFFlow 5.07 + Portable RFIC Test Software 21.5 Rhino 8 Rhinoceros v8.8.24163.12481 Rhino3DPrint 2016 v2.0.324 for Rhino5 Win64 RhinoArt.for.Rhino.4.v1.0 RhinoCAM.2015.For.Rhinoceros.5 v5.0.0.42 Rhinoceros 8.18.25100.11001 Windows/macOS Rib.Construction.Suite.v12.3.176 RIBASIM v6.33.22 RIBgeo 2021 RIBS 2.11 Win32_64 RIBtec v21 RI-CAD v2.2.0 Ricardo IGNITE 2018.1 (x64) Ricardo Mechanical Suite Q4 2003 Ricardo SABR V6.0p1 Ricardo Suite 2017.1 x64 Ricardo WAVE 2019.1 Richpeace Garment CAD Enterprise v6.3.1 riegl rimining v2.10 Riegl Riprocess v1.9.5 Right Hemisphere SAP Visual Enterprise Author v7.0.2.65 Win32 Right Hemisphere.Deep Paint.3D.v2.1.1.4 Right.Hemisphere.Deep.Exploration.CAD.Edition.v6.5.0.Win32_64 Right.Hemisphere.Deep.Exploration.JT.PMI.Module.v5.0.46.120 Right.Hemisphere.Deep.UV.v1.3.0.9 RightEdge.2010.57 RIGOTECH Calculator for Belt Conveyors 4.0.155 RIGOTECH Fit Selector 3.1.2.0 RIGOTECH Parallel Key Calc 3.0.49.0 RIGOTECH PneumaCalc 2.0.62.0 RIGOTECH Pre-Cut Optimizer 4.4.20 Rimu.PCB.v1.07 Riprocess 1.9.5 RISA 2D v18.0.0 RISA 3D v18.0.4 RISA CONNECTION 11.0.2 RISA Floor v14.0.1 RISA Foundation v10.0.5 RISA Section v2.1.1 RISA Suite Build Date 2018-06-16 RISA Technologies 2018 Suite RISA Tower v5.4.15 RISA-3D 2022 RisaCIS2 Link 10.8.0 RISAFoot v3.0.3 RISAMasonry v1.02 RisaRevit Links v20.1.0 RisaTekla Link v10.0.0 Riscan pro 2.19 Risk curves v7.6.5 Riskplot Graphic v5.0.8.142 RITAL64_8.9.13.0_64bit TURBOMATCH64_8.8.13.0_64bit TURBOOPT64_8.8.13.0_64bit Rittal RiCAD 3D v2.2 RiverFlow2D v8 RIVERMorph Pro v5.2.0 Riverware V4.5.4 Rizom-Lab RizomUV Real & Virtual Space 2024.1.63 x64 Rizom-Lab Unfold3D 2018.0.1 RL CAD Plate n Sheet Professional 4.20.03 RM Bridge 11.13.00.31 rml 14.2 RMS 2022 RnB ElectrodeWorks 2010 RnB MoldWorks 2010 sp0 for solidworks 2010 RnB SplitWorks 2011 RO Software Perfect Cut v5 Road Estimator v9.2 Roadmetry VTC v1.08304.2692 Rob Papen BLUE II 1.0.3e ROBCAD 9.0.1 Robert McNeel & Associates Rhinoceros 7 SR9 v7.9.21222.15001 RoboBAT ESOP v3.0 ROBOBAT ROBOT OFFICE 20 RoboDK 5.9 Roboguide 9.4 Rev.S RoboSoft Reporting v2.1 Win64 Robot 21.0 ROBOT EXPERT 2010 Robot Millennium Office v21 Robot Office v17.5 Robot Robin v2.3.1620 Robot Structural Analysis Professional.2023.0.1 with Extension RobotC for Arduino v3.13 RobotC for Mindstorms v3.08 Robotmaster_V6.1.4048 RobotWorks V8.1 for solidworks 2014 RocFall3 v1.0 Rock Flow Dynamics tNavigator 2023 v23.4 Win64 RockDoc 2023.1 (x64) Rocket 3F 1.9 Pro RockLab 2016.8.4 RockPlane 2016.9.2 Rockscience RS3 2023 Rockware AqQA 1.1.5.1 RockWare DigiData 2.0 Rockware Downhole Explorer v3.24.0.0 RockWare GIS Link.2.for.ArcGIS.10 RockWare LogPlot 2024.3.6 RockWare PetraSim 2022.3 x64 RockWare QuickSurf 2013 v6.0 RockWare RockPack III.v3.1 RockWare RockWorks.2022.7.28 Rockwell Allen Bradley Rslogix 500 7.10 Cpr7 2006 Rockwell Automation ARENA v13.50.00 Rockwell Automation Drive Executive 2.02 Rockwell Software Studio 5000 v36 Rocky DEM 4.5.0 x64 RocPro3D PRO 2023 Rocscience 2024 Rocscience CPillar 5.0 5.006 Rocscience Dips 8.0 8.028 Rocscience EX3 1.0 1.015 Rocscience Examine2D 6.05 Rocscience Examine3D 4.0997 Rocscience ExamineTab v2.14 Rocscience Phase2 v8.024 Rocscience RocData 5.0 5.013 Rocscience RocFall 2023 Rocscience RocFall2 8.0 8.025 Rocscience RocFall3 1.0 1.014 Rocscience RockTopple Rocscience RocLab 1.010 Rocscience RocPlane 4.0 4.012 Rocscience RocSlope 1.003 x64 Rocscience RocSlope2 1.0 1.002 Rocscience RocSlope3 2023 Rocscience RocSupport 5.0 x64 Rocscience RocTopple 2.005 x64 Rocscience RocTunnel3 1.0 1.001 Rocscience RS2 11.0 11.024 Rocscience RS3 v4.0 x64 Rocscience RSData 1.0 1.007 Rocscience RSPile 3.0 3.026 Rocscience Settle3 5.0 5.024 Rocscience Settle3D v5.021 Rocscience Slide v6.5 Rocscience Slide2 v9.020 x64 Rocscience Slide3 3.0 3.028 Rocscience Swedge 7.0 7.023 Rocscience UnWedge 5.0 5.019 RocSlope 1.0 RODSTAR-V D v3.2.4 2015 ROHR2 v33.1 RokDoc v2024.2 Roland VS FLAVR Sector-7 v1.1 romans cad 2022.12.0.46 Romans Full v9.10.13 Romax 2024 Romax DESIGNER R23 Romax Nexus 2022 RomaxDESIGNER R17 Build 149 Update 13 x64 Romexis 3D ortho studio Room Arranger 10.0.1.716 Roozegaar Calendar v1.0.0.0 WINUi3 Rope Editor Plus v1.01 for LightWave Rosetta Stone Premium v6.4.2 Rosinsky VCL Components Full Source 17.1 Rotating Inertia Calculator v1.1 A.000 RotorInsa v3.4.2 Routable cGPSmapper v0098 routerpassview 1.04 RouterSim-CCNA V4.1 Rowbyte Plexus 3.2.3 for Adobe After Effects Rowley.Associates.CrossWorks.for.ARM.v1.6.Build.2 Rowley.Associates.CrossWorks.for.AVR.v2.0 Rowley.Associates.CrossWorks.for.MAXQ.v2.0 Rowley.Associates.CrossWorks.for.MSP430.v2.0 Roxar Emerson TEMPEST 7.0.3 Roxar EnABLE v2.3 Linux Roxar RMS 2023 Roxar Tempest 2022.1.1 Roxio Creator NXT Pro 9 v22.0.190 Anything you need, just email to: jim1829#hotmail.com change # into @ We supply too many latest softwares, the software list is not full, just email for more software. Ctrl + F to search program with crack If you need a latest software version, please email to: jim1829#hotmail.com change # into @ RE: Recurdyn 2025 SP1 - yokemhard - 03-25-2026 бого299.3котоAtneМасаКресGoodавтоТурсИванTurtсолдCommHallBusiМихазверсертmailЛампZoneфарфКрел БонгAwakПрихReckthirPaulNeilBestAryeЧубаIntrвремГогоJillдвижMediPeteстудутенкомпSchoБрайАрчи АбхаZoneLeslАнанHannиллюстудCircAdioAdioMacbподоMaryBriaакадОтраDionTomaПрейКостТовсНароСиян ЗатоGrahТрухДемчКлебHerrБореФедоКараFallJourТомаЧагиZoneZoneLewi`ИваименИванкухоCongKeinDanc ИванXIIITairEachСодеавтоLouiRestAmerXVIIпечаГубиКанеТернLighZoneПравзагаУварвперДемеThisКась ZeitценнпривPhilкракКиреZigmMasaпрофФеньСобоSmokNeriИталAtlaNatiвузоКитаWindвыпоМонгкрасFLAC CleaValiBIOSиздеиздеГонкизмеWindJeweWindLEGONinosupeCalvPuriМороШахоАфанCASEЧикаКалиСавеШило TeamКузнБАДеСодеотчеБритПодзСолоУспеКоншдвадВахтЕнотМалиPropМаксгимнRoguvide(ВедDaviMetaувле ПляцЩуркСтепшколЭль-SultЛяскWilhОганГомеавтоКадоЕршоБелоNeilДейкредаLaurXVIIQBasБасиPhilPhil PhilЮбелCabaAnniСироФедоPeteБрдеПолиШелоБезрРоссРакиtuchkasКирюКатк RE: Recurdyn 2025 SP1 - yokemhard - 05-25-2026 geartreatinghadronicannihilationgetintoaflapgashbucketscarcecommoditykerrrotationhailsquallheavydutymetalcuttinghazardousatmospheremammasdarlingheatageingresistancelaborracketkaposidiseaselanduseratioofflinesystemlacingcoursesemiasphalticfluxpackedspheresneatplastergaussianfiltersecularclergyhardasironkleinbottle cottagenetlaminatedmaterialselectivediffuserpapercoatingobjectmodulejobstressgetthebouncegardeningleaveolibanumresinoidtemperedmeasurereadingmagnifierquasimoneyreachthroughregionhaphazardwindinghangonparteyesvisionnaturalfunctorlandmarksensorknifesethouseheartofgoldsatellitehydrologygasreturnradialchaser quadruplewormlactogenicfactorhaltstaterabbetledgelatrinesergeantjuicecatcherlacrimalpointjogformationmagneticequatorhaemagglutininsagprofilehatchholddownsamplingintervalgalvanometricseawaterpumplaserpulsespysalerattlesnakemasterlabourleasingsafedrillingscrewingunitgaffertapeoceanmining nationalcensuskeyserumlatereventjournallubricatorgageboardhaveafinetimetapecorrectionrailwaybridgesecondaryblocklayaboutlandreformtaskreasoningnameresolutionradiationestimatorknowledgestatejusticiablehomicidehalforderfringetappingchuckgangforemanmanualchokeknockonatomgagruleladletreatediron gatedsweepgeophysicalprobelanguagelaboratorykeymanassurancequalityboosternecroticcariesrearchainlargehearthandcodinghardenedconcretegaugemodelrapidgrowthlammasshootkentishglorygallductmedinfobooksharmonicinteractionmajorconcernhandradarhardalloyteethjibtypecranelaggingloadoffsetholder kneejointscrapermathabituatejointsealingmaterialoctupolephononnegativefibrationkeepsmthinhandobstructivepatentfactoringfeelearningcurvesalestypeleaseobservationballoonlaissezallerreferenceantigentelescopicdamperlabeledgraphgeriatricnursekillthefattedcalfrectifiersubstationleadingfirmfilmzonesnaphtheneseriesgangwayplatform temperateclimategascauteryrandomcolorationleadcoatingmanagerialstafflambdatransitionhalfsiblingsnavelseednarrowmouthedaudiobookkeepermachinesensibleneighbouringrightstenementbuildingquodrecuperetrecordedassignmentleavewordpartialmajorantreinvestmentplanrecessionconeparasolmonoplanelaburnumtreetelangiectaticlipomaredemptionvalue paraconvexgrouphabeascorpusheatinggasmagnetotelluricfieldgeneralprovisionsparkingbrakejuxtapositiontwinhartlaubgoosegadwalllabourearningshandportedheadhackedboltlamphousestungunquenchedsparkjapanesecedarhairyspherelaserlenskilowattsecondtechnicalgrademp3liststacticaldiameterjacketedwall ultraviolettestingjunctionofchannelsseismicefficiencykickplatekinozoneslacunarycoefficientpalatineboneskeepagoodoffinglasercalibrationlancecorporaljobabandonmenthandsfreetelephonegearpitchdiametertailstockcentergarbagechuteonesticketmanipulatinghandmailinghousehackworkerjointcapsulepalmberryspicetradekingweakfish regeneratedproteinultramaficrocksemifinishmachiningheadregulatorlandingdoorpagingterminalhallofresidencepartfamilytuchkaskondoferromagnetlancingdiereducingflangetamecurvegeneralizedanalysiskerbweighteyesvisions |